UGT1A9 Antibody
| Name | UGT1A9 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69689 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to UGT1A9(UDP glucuronosyltransferase 1 family, polypeptide A9) The peptide sequence was selected from the N terminal of UGT1A9. Peptide sequence LLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | UGT1A9 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: UGT1A9 Antibody [NBP1-69689] - This Anti-UGT1A9 antibody was used in Western Blot of 293T tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/14871_UGT1A9%2520Antibody-Western%2520Blot-NBP1-69689-img0001.jpg)
Western Blot: UGT1A9 Antibody [NBP1-69689] - This Anti-UGT1A9 antibody was used in Western Blot of 293T tissue lysate at a concentration of 1ug/ml.