PIGT Antibody
| Name | PIGT Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69585 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to PIGT(phosphatidylinositol glycan anchor biosynthesis, class T) The peptide sequence was selected from the N terminal of PIGT. Peptide sequence PLPSGDVAATFQFRTRWDSELQREGVSHYRLFPKALGQLISKYSLRELHL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PIGT |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PIGT Antibody [NBP1-69585] - This Anti-PIGT antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7023_PIGT-Antibody-Western-Blot-NBP1-69585-img0001.jpg)
Western Blot: PIGT Antibody [NBP1-69585] - This Anti-PIGT antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.
![Western Blot: PIGT Antibody [NBP1-69585] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 62500 Positive control: 721_B cell lysate PIGT is supported by BioGPS gene expression data to be expressed in 721_B.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7024_PIGT%2520Antibody-Western%2520Blot-NBP1-69585-img0002.jpg)
Western Blot: PIGT Antibody [NBP1-69585] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 62500 Positive control: 721_B cell lysate PIGT is supported by BioGPS gene expression data to be expressed in 721_B.