TMEM115 Antibody
| Name | TMEM115 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69572 |
| Prices | $329.00 |
| Sizes | 50 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TMEM115(transmembrane protein 115) The peptide sequence was selected from the N terminal of TMEM115. Peptide sequence LLSFAVDTGCLAVTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLTTVVV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TMEM115 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TMEM115 Antibody [NBP1-69572] - This Anti-TMEM115 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29766_TMEM115%2520Antibody-Western%2520Blot-NBP1-69572-img0001.jpg)
Western Blot: TMEM115 Antibody [NBP1-69572] - This Anti-TMEM115 antibody was used in Western Blot of Fetal Brain tissue lysate at a concentration of 1ug/ml.