CRISPLD2 Antibody
| Name | CRISPLD2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69620 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CRISPLD2(cysteine-rich secretory protein LCCL domain containing 2) The peptide sequence was selected from the N terminal of CRISPLD2. Peptide sequence MSCVLGGVIPLGLLFLVCGSQGYLLPNVTLLEELLSKYQHNESHSRVRRA. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CRISPLD2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CRISPLD2 Antibody [NBP1-69620] - This Anti-CRISPLD2 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7063_CRISPLD2-Antibody-Western-Blot-NBP1-69620-img0001.jpg)
Western Blot: CRISPLD2 Antibody [NBP1-69620] - This Anti-CRISPLD2 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1ug/ml.
![Western Blot: CRISPLD2 Antibody [NBP1-69620] - 1. Human Lung Fibroblast cells (40ug) 2. Mouse lung cells (40ug) Primary dilution: 1 : 2000 Secondary Antibody: Anti-rabbit IgG horseradish peroxidase Secondary dilution: 1 : 1000.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7064_CRISPLD2%2520Antibody-Western%2520Blot-NBP1-69620-img0002.jpg)
Western Blot: CRISPLD2 Antibody [NBP1-69620] - 1. Human Lung Fibroblast cells (40ug) 2. Mouse lung cells (40ug) Primary dilution: 1 : 2000 Secondary Antibody: Anti-rabbit IgG horseradish peroxidase Secondary dilution: 1 : 1000.