ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5 Antibody
| Name | ST6 GalNAc alpha-2,6-sialyltransferaseV/ST6GALNAC5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69618 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ST6GALNAC5(ST6 -N-acetylgalactosaminide alpha-2,6-sialyltransferase 5) The peptide sequence was selected from the middle region of ST6GALNAC5. Peptide sequence AFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFTMTIALE |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | ST6GALNAC5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ST6GALNAC5 Antibody [NBP1-69618] - This Anti-ST6GALNAC5 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1.25ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/14936_ST6GALNAC5%2520Antibody-Western%2520Blot-NBP1-69618-img0001.jpg)
Western Blot: ST6GALNAC5 Antibody [NBP1-69618] - This Anti-ST6GALNAC5 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1.25ug/ml.