TXNDC15 Antibody
| Name | TXNDC15 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69614 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Synthetic peptides corresponding to TXNDC15(thioredoxin domain containing 15) The peptide sequence was selected from the C terminal of TXNDC15. Peptide sequence STRFGTVAVPNILLFQGAKPMARFNHTDRTLETLKIFIFNQTGIEAKKNV. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TXNDC15 |
| Supplier Page | Shop |
Product images
![Western Blot: TXNDC15 Antibody [NBP1-69614] - This Anti-TXNDC15 antibody was used in Western Blot of Fetal Heart tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/14177_TXNDC15%2520Antibody-Western%2520Blot-NBP1-69614-img0001.jpg)
Western Blot: TXNDC15 Antibody [NBP1-69614] - This Anti-TXNDC15 antibody was used in Western Blot of Fetal Heart tissue lysate at a concentration of 1ug/ml.