MBOAT7 Antibody

Name MBOAT7 Antibody
Supplier Novus Biologicals
Catalog NBP1-69610
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LENG4 The peptide sequence was selected from the C terminal of LENG4. Peptide sequence LSAYWHGLHPGYYLSFLTIPLCLAAEGRLESALRGRLSPGGQKAWDWVHW.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene MBOAT7
Conjugate Unconjugated
Supplier Page Shop

Product images