CYP4B1 Antibody

Name CYP4B1 Antibody
Supplier Novus Biologicals
Catalog NBP1-69677
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CYP4B1(cytochrome P450, family 4, subfamily B, polypeptide 1) The peptide sequence was selected from the N terminal of CYP4B1. Peptide sequence SWAHQFPYAHPLWFGQFIGFLNIYEPDYAKAVYSRGDPKAPDVYDFFLQW.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CYP4B1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.