LRFN5 Antibody
| Name | LRFN5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69704 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to LRFN5(leucine rich repeat and fibronectin type III domain containing 5) The peptide sequence was selected from the middle region of LRFN5. Peptide sequence PLITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATR |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | LRFN5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: LRFN5 Antibody [NBP1-69704] - This Anti-LRFN5 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/14829_LRFN5%2520Antibody-Western%2520Blot-NBP1-69704-img0001.jpg)
Western Blot: LRFN5 Antibody [NBP1-69704] - This Anti-LRFN5 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.