Name | CYP20A1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-69680 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to CYP20A1(cytochrome P450, family 20, subfamily A, polypeptide 1) The peptide sequence was selected from the N terminal of CYP20A1. Peptide sequence ITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTV. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | CYP20A1 |
Conjugate | Unconjugated |
Supplier Page | Shop |