TMED4 Antibody
| Name | TMED4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69259 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to TMED4(transmembrane emp24 protein transport domain containing 4) The peptide sequence was selected from the middle region of TMED4. Peptide sequence DIQVGEHANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYREER. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TMED4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TMED4 Antibody [NBP1-69259] - This Anti-TMED4 antibody was used in Western Blot of Liver tissue lysate at a concentration of 0.5ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15068_TMED4%2520Antibody-Western%2520Blot-NBP1-69259-img0001.jpg)
Western Blot: TMED4 Antibody [NBP1-69259] - This Anti-TMED4 antibody was used in Western Blot of Liver tissue lysate at a concentration of 0.5ug/ml.