SYT11 Antibody

Name SYT11 Antibody
Supplier Novus Biologicals
Catalog NBP1-69190
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SYT11 (synaptotagmin XI) The peptide sequence was selected from the N terminal of SYT11. Peptide sequence AGLLSRDKDPRGPSSGSCIDQLPIKMDYGEELRSPITSLTPGESKTTSPS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SYT11
Conjugate Unconjugated
Supplier Page Shop

Product images