DPY19L2 Antibody
| Name | DPY19L2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69236 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | Synthetic peptides corresponding to DPY19L2(dpy-19-like 2 (C. elegans)) The peptide sequence was selected from the middle region of DPY19L2. Peptide sequence IIGEFNNLPQEELLQWIKYSTTSDAVFAGAMPTMASIKLSTLHPIVNHPH. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | DPY19L2 |
| Supplier Page | Shop |
Product images
![Western Blot: DPY19L2 Antibody [NBP1-69236] - This Anti-DPY19L2 antibody was used in Western Blot of Fetal Heart tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/14202_DPY19L2%2520Antibody-Western%2520Blot-NBP1-69236-img0001.jpg)
Western Blot: DPY19L2 Antibody [NBP1-69236] - This Anti-DPY19L2 antibody was used in Western Blot of Fetal Heart tissue lysate at a concentration of 1ug/ml.