LRCH4 Antibody
| Name | LRCH4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69265 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Synthetic peptides corresponding to LRCH4(leucine-rich repeats and calponin homology (CH) domain containing 4) The peptide sequence was selected from the middle region of LRCH4. Peptide sequence PGHRYDGGLDSGFHSVDSGSKRWSGNESTDEFSELSFRISELAR |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | LRCH4 |
| Supplier Page | Shop |
Product images
![Western Blot: LRCH4 Antibody [NBP1-69265] - This Anti-LRCH4 antibody was used in Western Blot of Transfected 293T tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/14210_LRCH4%2520Antibody-Western%2520Blot-NBP1-69265-img0001.jpg)
Western Blot: LRCH4 Antibody [NBP1-69265] - This Anti-LRCH4 antibody was used in Western Blot of Transfected 293T tissue lysate at a concentration of 1ug/ml.