Name | LRCH4 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-69265 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | Synthetic peptides corresponding to LRCH4(leucine-rich repeats and calponin homology (CH) domain containing 4) The peptide sequence was selected from the middle region of LRCH4. Peptide sequence PGHRYDGGLDSGFHSVDSGSKRWSGNESTDEFSELSFRISELAR |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | LRCH4 |
Supplier Page | Shop |