GAL3ST3 Antibody
| Name | GAL3ST3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69307 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GAL3ST3(galactose-3-O-sulfotransferase 3) The peptide sequence was selected from the C terminal of GAL3ST3. Peptide sequence VDIMGYDLPGGGAGPATEACLKLAMPEVQYSNYLLRKQKRRGGARARPEP. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | GAL3ST3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: GAL3ST3 Antibody [NBP1-69307] - This Anti-GAL3ST3 antibody was used in Western Blot of Fetal Liver tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16544_GAL3ST3%2520Antibody-Western%2520Blot-NBP1-69307-img0001.jpg)
Western Blot: GAL3ST3 Antibody [NBP1-69307] - This Anti-GAL3ST3 antibody was used in Western Blot of Fetal Liver tissue lysate at a concentration of 1ug/ml.