Semaphorin 6D Antibody
| Name | Semaphorin 6D Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69274 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SEMA6D(sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6D) The peptide sequence was selected from the N terminal of SEMA6D. Peptide sequence KLYSATVADFLASDAVIYRSMGDGSALRTIKYD |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SEMA6D |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SEMA6D Antibody [NBP1-69274] - This Anti-SEMA6D antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16546_SEMA6D%2520Antibody-Western%2520Blot-NBP1-69274-img0001.jpg)
Western Blot: SEMA6D Antibody [NBP1-69274] - This Anti-SEMA6D antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.