PPP1R15B Antibody
| Name | PPP1R15B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-74269 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to the C terminal of PPP1R15B. Immunizing peptide sequence SFCSVDPYNPQNFTATIQTAARIVPEEPSDSEKDLSGKSDLENSSQSGSL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PPP1R15B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PPP1R15B Antibody [NBP1-74269] - THP-1 Cell Lysate 1ug/ml Gel Concentration 12%](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16457_PPP1R15B%2520Antibody-Western%2520Blot-NBP1-74269-img0001.jpg)
Western Blot: PPP1R15B Antibody [NBP1-74269] - THP-1 Cell Lysate 1ug/ml Gel Concentration 12%