ARHGAP36 Antibody

Name ARHGAP36 Antibody
Supplier Novus Biologicals
Catalog NBP1-74250
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to the N terminal of RP13 102H20. 1. Immunizing peptide sequence KPDRALPIDRPNTLDKWFLILRGQQRAVSHKTFGISLEEVLVNEFTRRKH.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ARHGAP36
Conjugate Unconjugated
Supplier Page Shop

Product images