OR13C9 Antibody
| Name | OR13C9 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79985 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the middle region of human OR13C9. Peptide sequence IFYGTILFMYMKPKSKETLNSDDLDATDKIISMFYGVMTPMMNPLIYSLR. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | OR13C9 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: OR13C9 Antibody [NBP1-79985] - HepG2 cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14574_OR13C9-Antibody-Western-Blot-NBP1-79985-img0002.jpg)
Western Blot: OR13C9 Antibody [NBP1-79985] - HepG2 cell lysate, concentration 0.2-1 ug/ml.
![Immunohistochemistry: OR13C9 Antibody [NBP1-79985] - Human Brain Cellular data: Neural Cells Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14575_OR13C9-Antibody-Immunohistochemistry-NBP1-79985-img0003.jpg)
Immunohistochemistry: OR13C9 Antibody [NBP1-79985] - Human Brain Cellular data: Neural Cells Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.
![Immunohistochemistry: OR13C9 Antibody [NBP1-79985] - Human Kidney Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14576_OR13C9%2520Antibody-Immunohistochemistry-NBP1-79985-img0004.jpg)
Immunohistochemistry: OR13C9 Antibody [NBP1-79985] - Human Kidney Cellular data: Epithelial cells of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.