OR13C5 Antibody

Name OR13C5 Antibody
Supplier Novus Biologicals
Catalog NBP1-79975
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Rat, Dog
Antigen Synthetic peptide directed towards the middle region of human OR13C5. Peptide sequence CGTIFLMYMKPKSQETLNSDDLDATDKLIFIFYRVMTPMMNPLIYSLRNK.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene OR13C5
Supplier Page Shop

Product images