ZNF474 Antibody

Name ZNF474 Antibody
Supplier Novus Biologicals
Catalog NBP1-79974
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human ZNF474. Peptide sequence NDRLPVELHQPLPQKPQPLPNAQSSQAGPNQAQLVFCPHCSRIFTSDRLL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ZNF474
Conjugate Unconjugated
Supplier Page Shop

Product images