HIST1H2BK Antibody
| Name | HIST1H2BK Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79872 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human HIST1H2BKThe immunogen for this antibody is HIST1H2BK. Peptide sequence KKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFER. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | HIST1H2BK |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: HIST1H2BK Antibody [NBP1-79872] - Human Fetal Liver Lysate 1ug/ml Gel Concentration 10-20%](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15476_HIST1H2BK%2520Antibody-Western%2520Blot-NBP1-79872-img0001.jpg)
Western Blot: HIST1H2BK Antibody [NBP1-79872] - Human Fetal Liver Lysate 1ug/ml Gel Concentration 10-20%