SLC34A3 Antibody
| Name | SLC34A3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79995 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the middle region of human SLC34A3. Peptide sequence LLERLSELALGAASLTPRAQAPDILKVLTKPLTHLIVQLDSDMIMSSATG. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC34A3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SLC34A3 Antibody [NBP1-79995] - Titration: 0.2-1 ug/ml, Positive Control: COLO205 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/17057_SLC34A3%2520Antibody-Western%2520Blot-NBP1-79995-img0003.jpg)
Western Blot: SLC34A3 Antibody [NBP1-79995] - Titration: 0.2-1 ug/ml, Positive Control: COLO205 cell lysate.