ZNF565 Antibody

Name ZNF565 Antibody
Supplier Novus Biologicals
Catalog NBP1-79419
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the middle region of human ZNF565The immunogen for this antibody is ZNF565. Peptide sequence VSQLTHHQRIHTCEKPYECRECGMAFIRSSQLTEHQRIHPGIKPYECREC.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ZNF565
Conjugate Unconjugated
Supplier Page Shop

Product images