C7orf42 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-79208
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptide directed towards the N terminal of human C7orf42The immunogen for this antibody is C7ORF42. Peptide sequence FSINPLENLKVYISSRPPLVVFMISVSAMAIAFLTLGYFFKIKEIKSPEM.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: TMEM248
• Conjugate: Unconjugated

Product images

Western Blot: C7orf42 Antibody [NBP1-79208] - Hela cell lysate, concentration 0.2-1 ug/ml.