LAS2 Antibody
| Name | LAS2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79525 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the middle region of human C18orf54The immunogen for this antibody is C18ORF54. Peptide sequence PCSLDKLEADRSWENIPVTFKSPVPVNSDDSPQQTSRAKSAKGVLEDFLN. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | C18orf54 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: LAS2 Antibody [NBP1-79525] - Hela cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16454_LAS2-Antibody-Western-Blot-NBP1-79525-img0003.jpg)
Western Blot: LAS2 Antibody [NBP1-79525] - Hela cell lysate, concentration 0.2-1 ug/ml.