CCDC46 Antibody

Name CCDC46 Antibody
Supplier Novus Biologicals
Catalog NBP1-79545
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the C terminal of human CCDC46The immunogen for this antibody is CCDC46. Peptide sequence IEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFED.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CEP112
Conjugate Unconjugated
Supplier Page Shop

Product images