FNDC8 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-79657
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptide directed towards the N terminal of human FNDC8The immunogen for this antibody is FNDC8. Peptide sequence MASEALHQVGDGEEAVLKKENFNMMNALDQLPKPFSNPKSMNRTVTTKGL.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: FNDC8
• Conjugate: Unconjugated

Product images

Western Blot: FNDC8 Antibody [NBP1-79657] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.