MRO Antibody

Name MRO Antibody
Supplier Novus Biologicals
Catalog NBP1-79844
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the C terminal of human MROThe immunogen for this antibody is MRO. Peptide sequence VAKACKTTFQACSPYLKLKEEYSFQSEEDQRNTKLYQQLSHYHPEILQFF.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MRO
Conjugate Unconjugated
Supplier Page Shop

Product images