DCDC2 Antibody

Name DCDC2 Antibody
Supplier Novus Biologicals
Catalog NBP1-79649
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Antigen Synthetic peptide directed towards the N terminal of human Dcdc2a. Peptide sequence QIESGGNYVAGGPEAFKKLNYLDIGEIKKRPMEAVNTEVKPVIHSRINVS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene Dcdc2a
Conjugate Unconjugated
Supplier Page Shop

Product images