PHF11 Antibody

Name PHF11 Antibody
Supplier Novus Biologicals
Catalog NBP1-80054
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Dog
Antigen Synthetic peptide directed towards the middle region of human PHF11. Peptide sequence FSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPF.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene PHF11
Supplier Page Shop

Product images