PMCH Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-79956
• Prices: $139.00, $299.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptide directed towards the N terminal of human PMCHThe immunogen for this antibody is PMCH. Peptide sequence RLGKGFQKEDTAEKSVIAPSLEQYKNDESSFMNEEENKVSKNTGSKHNFL.
• Purity/Format: Protein A purified
• Description: Rabbit Polyclonal
• Gene: PMCH
• Conjugate: Unconjugated