HSFY1 Antibody
| Name | HSFY1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80129 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human HSFY1 (NP_149099). Peptide sequence SWDENGTCIVINEELFKKEILETKAPYRIFQTDAIKSFVRQLNLYGFSKI. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | HSFY1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: HSFY1 Antibody [NBP1-80129] - Human Liver cell lysate, concentration 5.0ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6886_HSFY1%2520Antibody-Western%2520Blot-NBP1-80129-img0002.jpg)
Western Blot: HSFY1 Antibody [NBP1-80129] - Human Liver cell lysate, concentration 5.0ug/ml.