ZNF264 Antibody
| Name | ZNF264 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80297 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human ZNF264. Peptide sequence AAAVLTDRAQVSVTFDDVAVTFTKEEWGQLDLAQRTLYQEVMLENCGLLV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ZNF264 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: ZNF264 Antibody [NBP1-80297] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24694_ZNF264-Antibody-Western-Blot-NBP1-80297-img0003.jpg)
![Immunohistochemistry: ZNF264 Antibody [NBP1-80297] - Human Lung cell Cellular data: alveolar cell Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24695_ZNF264-Antibody-Immunohistochemistry-NBP1-80297-img0004.jpg)