LCoR Antibody

Name LCoR Antibody
Supplier Novus Biologicals
Catalog NBP1-80260
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Antigen Synthetic peptide directed towards the N terminal of mouse A630025C20RIK. Peptide sequence QQFAAEYTSKTSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene Lcor
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.