TAF7L Antibody
| Name | TAF7L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80292 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Antigen | Synthetic peptide directed towards the middle region of mouse TAF7L. Peptide sequence EGKAERKKYNWKHGITPPLKNVRKKRFRKTTKKLPDVKQVDEINFSEYTQ. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | Taf7l |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TAF7L Antibody [NBP1-80292] - SP2/0 cell lysate, concentration 1.25ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/17302_TAF7L%2520Antibody-Western%2520Blot-NBP1-80292-img0002.jpg)
Western Blot: TAF7L Antibody [NBP1-80292] - SP2/0 cell lysate, concentration 1.25ug/ml.