KAT6B-MORF Antibody
| Name | KAT6B-MORF Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80324 |
| Prices | $329.00 |
| Sizes | 50 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human MYST4. Peptide sequence MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQ. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | KAT6B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: KAT6B-MORF Antibody [NBP1-80324] - Antibody Titration: 0.2-1 ug/ml Positive control: HepG2 cell lysate There is BioGPS gene expression data showing that KAT6B is expressed in HepG2.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/17281_KAT6B-MORF%2520Antibody-Western%2520Blot-NBP1-80324-img0001.jpg)
Western Blot: KAT6B-MORF Antibody [NBP1-80324] - Antibody Titration: 0.2-1 ug/ml Positive control: HepG2 cell lysate There is BioGPS gene expression data showing that KAT6B is expressed in HepG2.