TRMT1L Antibody
| Name | TRMT1L Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80371 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | Synthetic peptide directed towards the middle region of human C1orf25. Peptide sequence QFKSILLKYSTPTYTGGQSESHVQSASEDTVTERVEMSVNDKAEASGCRR. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TRMT1L |
| Supplier Page | Shop |
Product images
![Western Blot: TRMT1L Antibody [NBP1-80371] - Titration: 0.2-1 ug/ml, Positive Control: ACHN cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/14378_TRMT1L%2520Antibody-Western%2520Blot-NBP1-80371-img0003.jpg)
Western Blot: TRMT1L Antibody [NBP1-80371] - Titration: 0.2-1 ug/ml, Positive Control: ACHN cell lysate.