C7orf64 Antibody
| Name | C7orf64 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80470 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Synthetic peptide directed towards the C terminal of human DKFZP564O0523. Peptide sequence FLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHKLKEVISSVPK. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RBM48 |
| Supplier Page | Shop |
Product images
![Western Blot: C7orf64 Antibody [NBP1-80470] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/4713_C7orf64-Antibody-Western-Blot-NBP1-80470-img0003.jpg)
Western Blot: C7orf64 Antibody [NBP1-80470] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.