RIP5 Antibody
| Name | RIP5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91332 |
| Prices | $299.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rabbit |
| Antigen | Synthetic peptide directed towards the N terminal of human C20orf24. Peptide sequence MSGGRRKEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDEFLDVIYWFRQ. |
| Purity/Format | IgG purified |
| Description | Rabbit Polyclonal |
| Gene | C20orf24 |
| Supplier Page | Shop |
Product images
![Western Blot: RIP5 Antibody [NBP1-91332] - Titration: 2.5ug/ml Positive Control: Jurkat cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_6/5457_RIP5-Antibody-Western-Blot-NBP1-91332-img0004.jpg)
Western Blot: RIP5 Antibody [NBP1-91332] - Titration: 2.5ug/ml Positive Control: Jurkat cell lysate.