TNRC18B Antibody

Name TNRC18B Antibody
Supplier Novus Biologicals
Catalog NBP1-91426
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Bovine, Dog
Antigen Synthetic peptide directed towards the N terminal of human TNRC18. Peptide sequence GKEVKKENRGKGGAVSKLMESMAAEEDFEPNQDSSFSEDEHLPRGGAVER.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene TNRC18
Supplier Page Shop

Product images