Name | 5033411D12Rik Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-98273 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Antigen | The immunogen for this antibody is 5033411D12Rik antibody - C-terminal region of mouse protein (NP_619595). Peptide sequence ANYLIGQKEAKRWGTAHGSIVPYQAFKTKDGYLVIGAGNNQQFAVVCKIL. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | Sugct |
Conjugate | Unconjugated |
Supplier Page | Shop |