MTERFD2 Antibody

Name MTERFD2 Antibody
Supplier Novus Biologicals
Catalog NBP1-98416
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Antigen The immunogen for this antibody is Mterfd2 - C-terminal region. Peptide sequence LERLGRYQTPDKKGQTQIPNPSLRNILRVSEAEFLARTACSSVEEFQVFK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene Mterf4
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.