Name | sFRP-3/FRZB Antibody (1H8) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00002487-M05 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG2a Kappa |
Clone | 1H8 |
Applications | WB ELISA |
Species Reactivities | Human |
Antigen | FRZB (NP_001454, 102 a.a. - 190 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTY* |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | FRZB |
Conjugate | Unconjugated |
Supplier Page | Shop |