sFRP-3/FRZB Antibody (1H8)

Name sFRP-3/FRZB Antibody (1H8)
Supplier Novus Biologicals
Catalog H00002487-M05
Prices $359.00
Sizes 100 µg
Host Mouse
Clonality Monoclonal
Isotype IgG2a Kappa
Clone 1H8
Applications WB ELISA
Species Reactivities Human
Antigen FRZB (NP_001454, 102 a.a. - 190 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTY*
Purity/Format IgG purified
Description Mouse Monoclonal
Gene FRZB
Conjugate Unconjugated
Supplier Page Shop

Product images