HMGCS2 Antibody (1E9.)
| Name | HMGCS2 Antibody (1E9.) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00003158-M06 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 1E9. |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | HMGCS2 (NP_005509.1 424 a.a. - 508 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RVSQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLERVDEQHRRKYARRPV |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | HMGCS2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: HMGCS2 Antibody (1E9) [H00003158-M06] - Analysis of HMGCS2 expression in transfected 293T cell line by HMGCS2 monoclonal antibody (M06), clone 1E9. Lane 1: HMGCS2 transfected lysatE (56.6 KDa). Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/9880_HMGCS2%2520Antibody%2520(1E9)-Western%2520Blot-H00003158-M06-img0004.jpg)
Western Blot: HMGCS2 Antibody (1E9) [H00003158-M06] - Analysis of HMGCS2 expression in transfected 293T cell line by HMGCS2 monoclonal antibody (M06), clone 1E9. Lane 1: HMGCS2 transfected lysatE (56.6 KDa). Lane 2: Non-transfected lysate.
![Sandwich ELISA: HMGCS2 Antibody (1E9) [H00003158-M06] - Detection limit for recombinant GST tagged HMGCS2 is approximately 1ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/9881_HMGCS2-Antibody-(1E9)-Sandwich-ELISA-H00003158-M06-img0003.jpg)
Sandwich ELISA: HMGCS2 Antibody (1E9) [H00003158-M06] - Detection limit for recombinant GST tagged HMGCS2 is approximately 1ng/ml as a capture antibody.