Name | HOXC5 Antibody (1E10.) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00003222-M01 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG2a Kappa |
Clone | 1E10. |
Applications | WB ELISA |
Species Reactivities | Human |
Antigen | HOXC5 (NP_061826.1, 1 a.a. - 68 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSSYVANSFYKQSPNIPAYNMQTCGNYGSASEVQASRYCYGGLDLSITFPPPAPSNSLHGVDMAANPR |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | HOXC5 |
Conjugate | Unconjugated |
Supplier Page | Shop |