Name | PET112L Antibody (6B2) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00005188-M01 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG2a Kappa |
Clone | 6B2 |
Applications | WB ELISA |
Species Reactivities | Human |
Antigen | PET112L (NP_004555 466 a.a. - 556 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SAAKQVFEELWKREGKTPGQIVSEKQLELMQDQGALEQLCHSVMEAHPQVVMDVKNRNPRAINKLIGLVRKATQSRADPVMIKEILEKKLS |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | GATB |
Conjugate | Unconjugated |
Supplier Page | Shop |