TPD52 Antibody (1B6)
| Name | TPD52 Antibody (1B6) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00007163-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2b Kappa |
| Clone | 1B6 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | TPD52 (NP_005070, 100 a.a. - 184 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | TPD52 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TPD52 Antibody (1B6) [H00007163-M01] - Analysis of TPD52 expression in transfected 293T cell line by TPD52 monoclonal antibody (M01), clone 1B6.Lane 1: TPD52 transfected lysate(19.863 KDa).Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/10373_TPD52%2520Antibody%2520(1B6)-Western%2520Blot-H00007163-M01-img0004.jpg)
Western Blot: TPD52 Antibody (1B6) [H00007163-M01] - Analysis of TPD52 expression in transfected 293T cell line by TPD52 monoclonal antibody (M01), clone 1B6.Lane 1: TPD52 transfected lysate(19.863 KDa).Lane 2: Non-transfected lysate.
![Sandwich ELISA: TPD52 Antibody (1B6) [H00007163-M01] - Detection limit for recombinant GST tagged TPD52 is approximately 1ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/10374_TPD52-Antibody-(1B6)-Sandwich-ELISA-H00007163-M01-img0003.jpg)
Sandwich ELISA: TPD52 Antibody (1B6) [H00007163-M01] - Detection limit for recombinant GST tagged TPD52 is approximately 1ng/ml as a capture antibody.