Name | Dlx1 Antibody (1B2) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00001745-M12 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG2a Kappa |
Clone | 1B2 |
Applications | WB ELISA |
Species Reactivities | Human |
Antigen | DLX1 (NP_835221, 181 a.a. - 254 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSWYPSAHQEAMQQPQL* |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | DLX1 |
Conjugate | Unconjugated |
Supplier Page | Shop |