HOXD11 Antibody (6D8)

Name HOXD11 Antibody (6D8)
Supplier Novus Biologicals
Catalog H00003237-M06
Prices $359.00
Sizes 100 µg
Host Mouse
Clonality Monoclonal
Isotype IgG2a Kappa
Clone 6D8
Applications WB ELISA
Species Reactivities Human
Antigen HOXD11 (NP_067015, 1 a.a. - 76 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNDFDECGQSAASMYLPGCAYYVAPSDFASKPSFLSQPSSCQMTFPYSSNLAPHVQPVREVAFRDYGLERAKWPYR
Purity/Format IgG purified
Description Mouse Monoclonal
Gene HOXD11
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.